PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID AHYPO_013880-RA
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; Caryophyllales; Amaranthaceae; Amaranthus
Family MYB
Protein Properties Length: 422aa    MW: 46437.2 Da    PI: 6.2895
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
AHYPO_013880-RAgenomeBYUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding58.51.5e-183984147
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47
                     rg+W++eEd +l ++v ++G ++W++Iar ++ gR++k+c++rw + 
  AHYPO_013880-RA 39 RGPWSPEEDAILSELVSKFGARNWSLIARGIP-GRSGKSCRLRWCNQ 84
                     89******************************.***********985 PP

2Myb_DNA-binding53.84.4e-1791135147
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                      r+++++eEd++++ a++ +G++ W+ Ia+ ++ gRt++ +k++w++ 
  AHYPO_013880-RA  91 RKPFSEEEDQIIISAHAIHGNK-WACIAKLLP-GRTDNAIKNHWNST 135
                      789*******************.*********.***********986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129426.0373489IPR017930Myb domain
SuperFamilySSF466892.12E-3136132IPR009057Homeodomain-like
SMARTSM007174.1E-163887IPR001005SANT/Myb domain
PfamPF002491.0E-173984IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.7E-264092IPR009057Homeodomain-like
CDDcd001673.34E-154183No hitNo description
SMARTSM007177.6E-1690138IPR001005SANT/Myb domain
PROSITE profilePS5129422.22490140IPR017930Myb domain
PfamPF002492.5E-1591135IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.1E-2393139IPR009057Homeodomain-like
CDDcd001673.18E-1293136No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009651Biological Processresponse to salt stress
GO:0009723Biological Processresponse to ethylene
GO:0009733Biological Processresponse to auxin
GO:0009737Biological Processresponse to abscisic acid
GO:0009739Biological Processresponse to gibberellin
GO:0009751Biological Processresponse to salicylic acid
GO:0009753Biological Processresponse to jasmonic acid
GO:0005634Cellular Componentnucleus
GO:0005737Cellular Componentcytoplasm
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 422 aa     Download sequence    Send to blast
MSDQPITTED PNDFTSPDAA IITVDAVETT VKRSSSRVRG PWSPEEDAIL SELVSKFGAR  60
NWSLIARGIP GRSGKSCRLR WCNQLDPCVK RKPFSEEEDQ IIISAHAIHG NKWACIAKLL  120
PGRTDNAIKN HWNSTLRRRY DFGKSMGEAS TDRNKDSSEE TISGETNSFK AVDGRQDLKQ  180
DVNMMDNQCD QSECQASPIR SLHPYTQPEI QPQIMYPSHH YVVAHPPVFP YFVKPTPVEP  240
PTLSRPVARI GAFNMYQPPS ESTPTAPPPR PVPVQGPLVN AFPDFGVSKF LEGIQCEPII  300
PSRCGHGCCS SPTGIESRTS LLGPEFVDYE EPPSFSSHEL AAIATDLNNI AWIKSGLDGG  360
CARQTETPLE RKDSDNSKQC IHKTNNAHFD GGRTKLMGMM SEVISTQIPR QTVTLPAEVG  420
V*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A2e-41381416109B-MYB
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010690407.10.0PREDICTED: uncharacterized protein LOC104903953
TrEMBLA0A0J8CXH10.0A0A0J8CXH1_BETVU; Uncharacterized protein
STRINGVIT_08s0007g01540.t011e-132(Vitis vinifera)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G55730.13e-99myb domain protein 109